PostYou are now at: Home » Products » Chemicals » Chemical Waste »

ACTH (1-39) for Polypeptide special products

Click image to view original image
Brand: Guangzhouquana
型号: skype;Candice148722
Price: Negotiable
Min.Order:
Supply
Delivery: Shipment within 3 days since the date of payment
Address: China
Valid until: Never Expire
Updated on: 2015-06-02 11:06
Hits: 2078295
Enquiry
Company Detail
 
 
Details
 ACTH (1-39)  for Polypeptide special products

skype;Candice148722 

whatsApp:8618038176817

if you are interested in my products,pls contact me,thanks 

Quick Details:
ACTH (1-39) 10mg Peptide
Product Name: ACTH (1-39),
Size: 10mg.
Molecular Formula: C207H308N56O58S1
Molecular Weight: 4541.1
CAS: 9002-60-2
Sequence (One-Letter Code): SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
Sequence (Three-Letter Code): H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
Product Description:
Adrenocorticotropic hormone, commonly referred to as ACTH and also known as corticotropin, is a polypeptide hormone produced in and secreted by the anterior pituitary gland. It is a key component in the hypothalamic-pituitary-adrenal axis, often produced in response to exogenous biological stress along with corticotropin-releasing hormone (which is also from the hypothalamus.) Its effects include increased production and release of corticosteroids and, as its name suggests, cortisol from the adrenal cortex.
ACTH is sometimes indicated as part of an emergency treatment for sepsis, although:
Surviving Sepsis Campaign guidelines suggest that corticosteroid therapy should be considered for adult septic shock when hypotension responds poorly to adequate fluid resuscitation and vasopressors, regardless of any results of diagnostic tests. However, steroid treatment may be associated with an increase risk of infection.... Baseline cortisol level < or = 35 microg/dl is a useful diagnostic threshold for diagnosis of steroid responsiveness in Thai patients with septic shock and ACTH stimulation test should not be used.
ACTH deficiency state can result from ACTH underproduction or tissue resistance; decreased production may be due to intrinsic pituitary disease (secondary) or may result from deficiency of CRH because of a hypothalamic disorder (tertiary). ACTH deficiency can be congenital or acquired, familial or sporadic, and partial or complete. It may occur as an isolated deficiency or as a part of a more global hypopituitarism.
Total: 0 [Show All]  Related Reviews
 
More »Our Others Products

[ ProductsSearch ]  [ Add To Favourite ]  [ Tell Friends ]  [ Print Content ]  [ Violation Report ]  [ Close Window ]