PostYou are now at: Home » Products » Chemicals » Chemical Waste »

IGF-1 LR3 (Long R3 IGF-1)

Click image to view original image
Brand: Guangzhouquanao
型号: skype;Candice148722
Price: Negotiable
Min.Order:
Supply
Delivery: Shipment within 3 days since the date of payment
Address: China
Valid until: 2032-11-03
Updated on: 2015-06-02 11:07
Hits: 1161778
Enquiry
Company Detail
 
 
Details
 IGF-1 LR3 (Long R3 IGF-1)
skype;Candice148722 

whatsApp:8618038176817

if you are interested in my products,pls contact me,thanks

Quick Details:
Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA 
Molar Mass: 9,111 Da 
Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1
IGF-1 LR3 (Long R3 IGF-1)
Product Description:
The Sequence of IGF-1 LR3 and Muscle Growth
The polypeptide Long R3 Insulin-like Growth Factor-I (IGF1 LR3) is an 83 amino acid analog of IGF-I actually comprising the complete IGF-1 sequence but with the substitution of an Arginine (Arg) for the Glutamic Acid (Glu) at position 3, as well as a 13 amino acid extension peptide. This sequence change causes IGF-1 LR3 to avoid binding to proteins and allow it to have a much longer half life, around 20-30 hours. This analog of IGF-1 has been produced with the purpose of increasing the biological activity of the IGF peptide.” IGF stands for insulin-like growth factor. Among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, and decreased protein degradation. When IGF is active it behaves differently in different types of tissues. In muscle cells proteins and associated cell components are stimulated. Protein synthesis is increased along with amino acid absorption. As a source of energy, IGF-1 LR3 mobilizes fat for use as energy in adipose tissue. In lean tissue, IGF-1 LR3 prevents insulin from transporting glucose across cell membranes. As a result the cells have to switch to burning off fat as a source of energy.
The Half-Life of IGF-1 LR3 and its Effects of IGF-1
It has a considerably longer half-life than other form, nearly 20-30 hours. When IGF-1 LR3 is active, has multiple effects on tissues in muscle cells. It plays a essential role in muscle renewal. IGF-1 LR3 encourages both increase as well distinction of stem cells. IGF-1 LR3 increases satellite cell activity, muscle DNA, muscle protein content, muscle weight and muscle cross sectional area. The importance of IGF-1 LR3 lies in the fact that all of its obvious effects work to induce muscle growth. These effects are enhanced when combined with weight training.
IGF-1 LR3 used in CLINICAL RESEARCH
IGF-1 LR3 plays an important part in childhood growth and continues to have results in adults. It is made in the human body and is at ideal levels during puberty. In most studies, the maximum active length for research studies IGF-1 LR3 is 50 days on also 20-40 days off. The most common range used during clinical research is typically between 20mcg to 120mcg per day.
During puberty, IGF is the most responsible for the natural muscle growth that occurs during these few years. There are many different things that IGF does in the human body; among the effects the most positive are increased amino acid transport to cells, increased glucose transport, increased protein synthesis, decreased protein degradation and increased RNA synthesis. 
Perhaps the most interesting and potent effect IGF has on the human body is its ability to cause hyperplasia, which is an actual split-ting of cells.
Total: 0 [Show All]  Related Reviews
 
More »Our Others Products

[ ProductsSearch ]  [ Add To Favourite ]  [ Tell Friends ]  [ Print Content ]  [ Violation Report ]  [ Close Window ]